SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018571 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018571
Domain Number 1 Region: 38-151
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.14e-36
Family Frizzled cysteine-rich domain 0.00019
Further Details:      
 
Domain Number 2 Region: 178-284
Classification Level Classification E-value
Superfamily TIMP-like 0.0000432
Family Tissue inhibitor of metalloproteinases, TIMP 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018571   Gene: ENSLACG00000016352   Transcript: ENSLACT00000018704
Sequence length 295
Comment pep:novel scaffold:LatCha1:JH126763.1:1545688:1551699:1 gene:ENSLACG00000016352 transcript:ENSLACT00000018704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLNTCKKKKKMFSATPVFFGLCSLLGLVQGFDIGLSTKCVAIPRELDMCHDVGYSEMRL
PNLLRDTSMEEVLRKAGQWQQLLQTGCHPQARLFLCSLFAPVCLDTFLHPCRSMCVAVRD
SCAPVVACHGQSWPEMLNCDRFPADEDMCLASISEELELYFKAWPRPTCQGCPALEEPYL
YKRVLEAFCDNNFAVKVKLTKRRTNFGDHDYKVEGRVEFIHQGALLLYNTRNLIQQWLHI
NENCAQRMIHTNRPTHYVIAGEIQDGRVVVHRVFHWHKKDAYLILATRKWRHHKC
Download sequence
Identical sequences H3B9K0
ENSLACP00000018571 ENSLACP00000018571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]