SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018675 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018675
Domain Number 1 Region: 28-146
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.4e-43
Family Frizzled cysteine-rich domain 0.000000411
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000018675
Domain Number - Region: 227-471
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0696
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018675   Gene: ENSLACG00000016443   Transcript: ENSLACT00000018808
Sequence length 575
Comment pep:novel scaffold:LatCha1:JH126848.1:1576657:1578384:-1 gene:ENSLACG00000016443 transcript:ENSLACT00000018808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQCLLLASVQFLLECPSFGFGASKEIVCQEITVPMCQNIGYNFTYMPNQFNHDSQDEAGL
EVHQFWPLVEIQCSPDLRFFLCSMYTPICLSDYKKPLPPCRSVCERARAGCSPLMRQYGF
AWPERMYCDKLPVQGDPENLCMDYNRTEATTVNPPYLKPTNPPKGPNKNTRPGKLPTNKN
RTPTGECDGGCKCKEPLVQISKESHPLYNKVKTGKVPNCVIPCYEPYFTQDERTFATFWI
GLWSILCFISTFTTVATFLIDMERFKYPERPIIFLSACYLFVSIGYIVRLIAGHANIACN
KDYNHIHYETTGPALCTVVFLLIYFFGMASSIWWVILSFTWFLAAGMKWGNEAIASYSQY
FHMAAWLIPSVKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVVYLFTGTMFL
LAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGLFTVLYTVPATIVVACNIYEQHYRENWE
KALNCSCPGDKNQPRPNYAVFMLKYFMCLLVGITSGVWIWSGKTLDSWRRFTSRCCRGRK
PTNVSMYSEASTALTARTGVVSSASYHKQMPLSHV
Download sequence
Identical sequences H3B9V4
ENSLACP00000018675 ENSLACP00000018675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]