SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000019409 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000019409
Domain Number 1 Region: 27-192
Classification Level Classification E-value
Superfamily RUN domain-like 7.59e-43
Family RUN domain 0.0000767
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000019409
Domain Number - Region: 245-316
Classification Level Classification E-value
Superfamily Tropomyosin 0.0222
Family Tropomyosin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000019409   Gene: ENSLACG00000017072   Transcript: ENSLACT00000019544
Sequence length 445
Comment pep:novel scaffold:LatCha1:JH126680.1:1893267:1916606:1 gene:ENSLACG00000017072 transcript:ENSLACT00000019544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSCIQSAMALGLSSKKASSRNISVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFIN
FAAILEQILSHRFREYFPSGPISWFSSDGQRSFWDYIRLACSKVPNNCISSIENMENINT
SRAKGRAWIRVALMEKRLSEYIAIALRDTRTTRRFFDDGAIMLREESSVLTGMLIGLSAI
DFSFCLKGEVMDGKTLAVIDYTPYLKFTQSYDYLSDDEDGQSMDSSTSDDSIPEHPYLPL
VTDEDSWYSKCRKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENKRLQLRLEEVKVQN
QLEKKDLEAVILELQEQLTGLIPCDNIHLSKEMITPLVNQWPSLGTLNGEENATETKLFR
RHSFMSSEQLSAKNSLSSDSEMLGKGKPDEEPWGPTETGKDCTPSMLGLCGSLVSIPSCK
SLASLKSNECLVSVGNDDSPALTPS
Download sequence
Identical sequences H3BBY8
ENSLACP00000019409 ENSLACP00000019409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]