SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020007 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000020007
Domain Number - Region: 175-217
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0152
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020007   Gene: ENSLACG00000017587   Transcript: ENSLACT00000020145
Sequence length 270
Comment pep:novel scaffold:LatCha1:JH126623.1:2216378:2217449:1 gene:ENSLACG00000017587 transcript:ENSLACT00000020145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNTVQQYLILLKFVLRLFVSFFFFSFFFPEAFEIVIRHAKNYTNTMFKNQYRNMAMETFG
FVGKLFTDVSLYILGSDRNVNDIMNEFFDNLFPVVYSHLINPGFQEVSLDTVECLRRVRW
DMKTFGNFPKLIITRMSKSLLATRVFLQALNLGIEVINTTDHLKFSKDCGRALLKMWYCS
HCQGLLMTKPCVGYCQSVMESCLVSVFEIHNHWKEYIKSLEKLAIGMQGVYDMEYVLLNL
YSLIKDAVMYTQKNRGRLLSTKETQYHSDN
Download sequence
Identical sequences H3BDN6
ENSLACP00000020007 ENSLACP00000020007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]