SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020261 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020261
Domain Number 1 Region: 37-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.98e-42
Family Frizzled cysteine-rich domain 0.00000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020261   Gene: ENSLACG00000017807   Transcript: ENSLACT00000020401
Sequence length 552
Comment pep:novel scaffold:LatCha1:JH126680.1:2391654:2393312:1 gene:ENSLACG00000017807 transcript:ENSLACT00000020401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRKRIGVMFLLFWLNFFDVCWGQFQGERGISIPDHGFCQPISIPLCTDIAYNQTIMPNLL
GHTNQEDAGLEVHQFYPLVKVQCSPELKFFLCSMYAPVCTVLEQAIPPCRSICERARQGC
EALMNKFGFQWPERLRCENFPIHGAEQICVGQNHTDPEVTTVFPALKAQDAGNPSPPKYA
TPDHPFNCPAVLKVPAYLNYKFLDEKDCAAPCEPSKNNGYMFFNQDEIKFARIWILIWSV
LCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFILDDKVVCNESFSEG
GYKTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFH
LAAWAVPAIKTITILAMGQIDGDLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLA
GFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWEKS
WISQNCKTLAIPCPLQYTPRMTPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYT
RLATNKHGETTV
Download sequence
Identical sequences H3BEE0
ENSLACP00000020261 ENSLACP00000020261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]