SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021516 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021516
Domain Number 1 Region: 36-155
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.57e-43
Family Frizzled cysteine-rich domain 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021516   Gene: ENSLACG00000018906   Transcript: ENSLACT00000021657
Sequence length 583
Comment pep:novel scaffold:LatCha1:JH126567.1:5224548:5226299:-1 gene:ENSLACG00000018906 transcript:ENSLACT00000021657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALHLKIVITFLCQLMIAGSSLEIGSYDIERGREAKCEPIEIPMCQGIGYNMTRMPNYM
GHENQREAGIKLHEFAPLVEYGCHVHLKFFLCSLYAPMCTDQVSTSIPACKPMCEQAREK
CAPIMEQFSFGWPDSLDCSKLPTKHDPNALCMEAPENATTGEPHKGQGMLPVAPRPRPPG
AGEGRSPGPLGTCENPEKFQYVEKSLSCAPKCSPGVDVYWSREDKDFAFIWMAVWSTLCF
VSTAFTVLTFLLDPPRFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACDKENGELYI
IQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEAHSSFFHMAAW
GIPAMKTIVILTMRKVAGDELTGLCYVGSMDVNALTAFVLIPLSCYLVIGTSFILTGFVA
LFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIICYFYERLNMDYWKFRALEQ
NCRVFPGRRIIDCSLEASVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQKLCSREL
SSKARGKPCSGVTCNGTHCHYKAPAVTLHMTKTDPYLDNPTHV
Download sequence
Identical sequences H3BHZ5
XP_005986928.1.90931 ENSLACP00000021516 ENSLACP00000021516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]