SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021791 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021791
Domain Number 1 Region: 14-84
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000694
Family HLH, helix-loop-helix DNA-binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 79-121
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000641
Family Hairy Orange domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021791   Gene: ENSLACG00000019150   Transcript: ENSLACT00000021932
Sequence length 153
Comment pep:novel scaffold:LatCha1:JH126562.1:9899965:9902471:-1 gene:ENSLACG00000019150 transcript:ENSLACT00000021932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSNSIVDSTRDELTPKEESKLRRPAVEKMRRDRINGSIETESQKHHPSSKLEKAGILE
MAVSYLKQQSQQQLRTADFKRRLQQDYTKGYSRCLQETLSYLSLHDPKKDTGPKLLSHFH
RAESPAKDPCLPMSPLHSGSRPTSLTTALWRPW
Download sequence
Identical sequences H3BIS0
ENSLACP00000021791 ENSLACP00000021791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]