SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000023142 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000023142
Domain Number - Region: 7-60
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000115
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000023142   Gene: ENSLACG00000022206   Transcript: ENSLACT00000025900
Sequence length 72
Comment pep:novel scaffold:LatCha1:JH128890.1:312405:315715:-1 gene:ENSLACG00000022206 transcript:ENSLACT00000025900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKHMGEQLNKAYEAYRQACMERDEAQKELQQKTEFYEQKLHELREQYTAQTAFIARLLQ
VLLTFLGNSSGS
Download sequence
Identical sequences M3XK86
ENSLACP00000023142 ENSLACP00000023142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]