SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001301 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001301
Domain Number 1 Region: 114-196
Classification Level Classification E-value
Superfamily DEATH domain 6.48e-20
Family DEATH domain, DD 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001301   Gene: ENSLACG00000001167   Transcript: ENSLACT00000001313
Sequence length 197
Comment pep:novel scaffold:LatCha1:JH127209.1:11235:43042:1 gene:ENSLACG00000001167 transcript:ENSLACT00000001313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRSPTDIVTTTIPSSPRFIGSGNADKLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQG
ANNRTVNQTQSPEGEKLHSDSGISVDSQSLHDQPQPQQQLRQQTQASVKEESNLYTNLPP
HKQEEIEKLLNGSEEDAWCNLAGLLGYEEDHIDFLKQQEHPVQALLSDWSSKDSATVDVL
CNALKKMKREDIAESLL
Download sequence
Identical sequences H2ZV80
ENSLACP00000001301 ENSLACP00000001301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]