SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003323 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003323
Domain Number 1 Region: 97-221
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-17
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003323   Gene: ENSLACG00000002971   Transcript: ENSLACT00000003353
Sequence length 229
Comment pep:novel scaffold:LatCha1:JH127706.1:65891:94305:1 gene:ENSLACG00000002971 transcript:ENSLACT00000003353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMLLLVKMFNSIFLGPSEVSAAVRYNRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNKFAN
RGRLYATLGPNWRVPVRNSPRSRSCVYSPTGACSCQLGSPAGAIAMEGPLRRKTLLKEGK
KPALSSWTRYWVTLSGSTLLYFGVKSLRGKERKHYKSTPCKKVSIIGWMVVLPDDPEHPD
IFQLNDPDKGNVYKFQTGSRFHAILWHKHLGDACKSSRPQVPANLMSFE
Download sequence
Identical sequences H3A102
ENSLACP00000003323 ENSLACP00000003323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]