SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003413 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003413
Domain Number 1 Region: 548-916
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 7.98e-136
Family Hect, E3 ligase catalytic domain 0.000000000000879
Further Details:      
 
Domain Number 2 Region: 17-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-17
Family PLC-like (P variant) 0.00048
Further Details:      
 
Domain Number 3 Region: 452-491
Classification Level Classification E-value
Superfamily WW domain 0.00000000000000334
Family WW domain 0.0004
Further Details:      
 
Domain Number 4 Region: 382-416
Classification Level Classification E-value
Superfamily WW domain 0.000000000000178
Family WW domain 0.0012
Further Details:      
 
Domain Number 5 Region: 342-381
Classification Level Classification E-value
Superfamily WW domain 0.000000000000195
Family WW domain 0.0011
Further Details:      
 
Domain Number 6 Region: 495-529
Classification Level Classification E-value
Superfamily WW domain 0.00000000000991
Family WW domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003413   Gene: ENSLACG00000003046   Transcript: ENSLACT00000003443
Sequence length 922
Comment pep:novel scaffold:LatCha1:JH127294.1:68439:206624:1 gene:ENSLACG00000003046 transcript:ENSLACT00000003443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATASSRSDTSNNHNGRSQLHVVVSCARLKRKKNWFGATIFVELSADGITKKTAKSNGSN
PKWEEHLNVNVTQHTKLEFKVWSHHTLKADALLGKATVDLSQALEVHSRRLDNVKEVLKL
TVENKNGVVQTGELTVVLDGLSVDQDSLPNGNTPTTKVQQNGDAIHEGGSETPTMARARS
VSEASNGIDSQAPSCSSGLNADNIHVVNGESTASPLHVATRPKTTPAPKPPSNRFTNNTV
NGEPSSLPTTVSSTDSTETSTTTLCTNTSPAALPTVAAPSFSESTMATTSSSIANAAAPS
TSDTLAGAPASMDDDSSRSSTTTEGAKPRQSTNDASAEPVRQQPSSINSEPLPPGWEQRK
DPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRN
FEQWQSQRNQLQGAMQQFNQRYLYSASMLSAESDPLGPLPPGWERRVDSNDRVYFVNHNT
KTTQWEDPRTQGQQNENPLPEGWEIRYTREGVRYFVDHNTRTTTFSDPRTGKSSVTKGPQ
IAYERSFRWKLAHFRYLCQSNALPSHVKITVSRQTLFEDSFQQIMALKPYDLRRRLYVIF
RGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFI
GRFIAMALFHGKFIDTGFSLPFYKRMLNKKLTIKDLESIDPEFYNSLIWIRDNNIEECGL
EMYFSVDMEILGKVTSHDLKPGGTNLLVTEENKEEYIGLMAEWRFCRGVQDQTKSFLDGF
NEVVPLQWLQYFDEKELEVMLCGMQEVDLSDWQRNTVYRHYTRNSKQIAWFWQFVKEMDN
EVRLRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYK
SYEQLKEKLLFAIEETEGFGQE
Download sequence
Identical sequences H3A192
ENSLACP00000003413 XP_006001857.1.90931 XP_006001858.1.90931 ENSLACP00000003413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]