SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003580 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003580
Domain Number 1 Region: 139-466
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.11e-70
Family Pancreatic carboxypeptidases 0.00000764
Further Details:      
 
Domain Number 2 Region: 2-122
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.1e-30
Family Frizzled cysteine-rich domain 0.00049
Further Details:      
 
Domain Number 3 Region: 466-544
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.14e-17
Family Carboxypeptidase regulatory domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003580   Gene: ENSLACG00000003187   Transcript: ENSLACT00000003612
Sequence length 611
Comment pep:novel scaffold:LatCha1:JH129155.1:73760:128093:-1 gene:ENSLACG00000003187 transcript:ENSLACT00000003612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVCTGITLAYCDDVAYSNTMYPNLLDQKNREEIEFSAEYVLLSVIDTLLQGECNPDLRIL
GCSILAPRCEKNKILKPCISVCESLRKSCMHAFEAIDMAWPYFLDCDRFFVGEQEGCYDP
LEKLRGVTEITEEELLEPPSTFIHFTHNSYSQMNNILKKTAAKCSQVSKVHSIGRSYEGK
DLLVIEFSSNPGQHELFEPEFKYIANIHGNEVLGRELLIYLAQYLCSEYLLGNPRIQTLI
NNTRIHLLPSLNPDGYEIAAEEGAGYNGWTSGRQNAQSLDLNRNFPDLTSIVYQRRRIRG
ARTDHIPIPESYWWGKIAPETKAVMKWMRSIPFVLSGSLHGGDLVATYPYDLSKHPEEAK
MFSPTPDDQILRNSSKEGYRIMCPLLWQKCQEIVGRNFKNDRSSMNVAYWLSIAPKMADF
NYLHTNCFEVTLELGCEKFPPEDELYSGWQENKESLLNFIEMVHRGIKGVVKDVEGNGIK
GARISVKGIRHDILTASDGDYWRLLPPGKYIISAEAPGFSKAMKKIYLPARMRKAGQVDF
TLQHIVTEPGLSDNFPTENYEQFDPLDHFDPHARREPTGDEEEVSTARKMPWWWSYFSVV
GQNAPVWLLKN
Download sequence
Identical sequences H3A1Q9
ENSLACP00000003580 ENSLACP00000003580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]