SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004157 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004157
Domain Number 1 Region: 20-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.13e-81
Family Ankyrin repeat 0.0000149
Further Details:      
 
Domain Number 2 Region: 412-499
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000198
Family DEATH domain, DD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004157   Gene: ENSLACG00000003696   Transcript: ENSLACT00000004193
Sequence length 501
Comment pep:novel scaffold:LatCha1:JH127935.1:92749:131670:-1 gene:ENSLACG00000003696 transcript:ENSLACT00000004193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDAISSRNIPVLQSEKDFQNAAHLNDLGTMTILFEKNVDINARNHLDRTALHYAVAGNH
EDAIKFLVDHKARVNVPDKRKSNSTSEVTKCHGITALHLASWHGSLPILEMLVKAGARQK
EKNQDGMNILHFAACNNHSHIVEYIIADLQIKDLCQCDENGKKPFHLAAENGHVQMLETL
MNLNFFTQEKDKEGNTALHLAAKNGHIEVIEFLIMNWEEVNDTNEAGETAFFLAVSGAHE
ECAELLLRAGSDVNNLTKNNMSALHEAAQNCYLSLVNFLIKKNVDLEAQNEQKCSAIHLA
VKKKNIPVIHILMKEKCNINAVDNRNQTPLHMAAELGDIEVVEMLLKAGADLTIKDKKGK
TPLDVAARSNYILIVDMIIKAERYFTWKQANAESVHPNENYPLTFKLDHTIKTMQIRTVI
WNLANNQLKPNEWKSLALKWEFTEQQIKAIGEQWIGTKSYKEHGHRLLLIWLHGILLAQQ
NPVKHLYEGLIHLGRATLAGE
Download sequence
Identical sequences H3A3D6
ENSLACP00000004157 ENSLACP00000004157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]