SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005003 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005003
Domain Number 1 Region: 143-457
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.16e-99
Family Protein kinases, catalytic subunit 0.0000000000641
Further Details:      
 
Domain Number 2 Region: 12-113
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-17
Family Pleckstrin-homology domain (PH domain) 0.0000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005003   Gene: ENSLACG00000004447   Transcript: ENSLACT00000005047
Sequence length 478
Comment pep:novel scaffold:LatCha1:JH126564.1:124076:159519:-1 gene:ENSLACG00000004447 transcript:ENSLACT00000005047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITLVLNTREFTLYFAGEYIKTWRPRYFLLKTDGTFIGYKERPQDVDQLESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTKAIQTVADRLKKQEEEMMDF
NSPSDNSDAGEMEVSLTRPKHRVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILK
KEVIVAKDEVAHTLTENRVLQNSKHPFLTGLKHSFQTHDRLCFVMEYANGGELFFHLSRE
RVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKD
GATMKTFCGTPEYLAPEVLEDNDYDRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL
MEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMHHKFFAGIVWQDVYERKLV
PRFKPQVTSETDTRYFDEEFTAQTITITPPDQDDNMEFVDNERRPHFPQFSYSASGTA
Download sequence
Identical sequences H3A5T2
ENSLACP00000005003 ENSLACP00000005003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]