SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005055 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005055
Domain Number 1 Region: 326-590
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-58
Family Nuclear receptor ligand-binding domain 0.0000000129
Further Details:      
 
Domain Number 2 Region: 254-331
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.25e-28
Family Nuclear receptor 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005055   Gene: ENSLACG00000004496   Transcript: ENSLACT00000005101
Sequence length 592
Comment pep:novel scaffold:LatCha1:JH128656.1:125466:159380:1 gene:ENSLACG00000004496 transcript:ENSLACT00000005101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGPSPPGSSYVSQTYAYGGEYSPEVMNPDYTKIGMELVNTEITAAATTSLPSF
STFVEGYTYDLKPSCLYQMQSQRPLIKVEDPHLHGYQSPIPPQTEDVMPSSSMYFKQSPP
STPTTPGFSTQQASIWDESHSLPPSQTRMSTSHLMEAPMKTIPPRFPLFPFKQSPPHTTA
SSSHMCYEPVLNISMGTERSSGQPVMDTHQYPLSVAKGSGLSFPHLTLSHGSNLLGDSSL
PSPSSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVD
KRRRNRCQYCRFEKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPTVS
LISALVRALTESTPRDLDYSRFCATEQPAAGSDTEYVQQFYSLLTSSMEISRSWAEKIPG
FTDLPKEDQMLLAESGFLEPFVLRLASRSIPVEDKFVFCNGLVLHRQQCLRGFGEWIDSI
KEFSSNLQSLNLDISVLACLSALSIITERHGLKEPKKVEELRNKIQSSLKDHLMFSSPGQ
NKGQQLSKVLSILSDLRCLCTLGLQRIFYLKLEDLVMPPPVIDKLFLDTLPF
Download sequence
Identical sequences H3A5Y4
XP_006009684.1.90931 XP_006009685.1.90931 ENSLACP00000005055 ENSLACP00000005055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]