SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005472 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005472
Domain Number 1 Region: 14-53,174-311
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-22
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Domain Number 2 Region: 416-507
Classification Level Classification E-value
Superfamily PH domain-like 2.54e-20
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005472   Gene: ENSLACG00000004868   Transcript: ENSLACT00000005520
Sequence length 766
Comment pep:novel scaffold:LatCha1:JH127531.1:142490:188250:1 gene:ENSLACG00000004868 transcript:ENSLACT00000005520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPVLEQLIPELNVLLKLLDHEYLSTTTREKKAAVSNILQRLQPKSGNETDYMYMNTSVY
RNGTSFVESLFDEFDCDLQDLKDMQEDSKDESEAQVPEISQPKLATNDTPPPLPTTPPPE
DYYEEAVPLSPGKVPEYITSRNSSSPPNSIEDGYYEDADNNYPVTRINGEQKNSYNDSDV
MSSSYESYDEEEDEGKGQQLTHQWPSEEASMDLVKDCKICTFLLRKKRFGQWAKQLTVIK
DNKLMVYKSSKDQQPQLELPLNVCNVIYVPKDGRRKKHELRFSLPGTEALVLAVQSKEQA
EEWLKVIKEVSSQCNGGIGIEGSTSPLILHKLELDKRLSLEKQTSDSDSAVTGENGSPVI
RRERREWVKGKKSGLAELKGSVSRAAGRKITRIISFSKKKPSIEDTQPSSSEEDVPCCGY
LNVLVNQCWKERWCRLKGNTLYFHRDRIDLRTHVNVIMLQGCEVKPGMGPKHPFAFRLLR
HGQEISVLEANSSEEMGQWLGLLLAATGTNADPEALHYDYVDVETIANIVDAVRHSFLWA
TSCHNDEGECRTYDEVPYEKLQDDDQKRPTTTQVKRHSSSVSDTSHKVNPQVKIKRHGSN
ANQYKYGKTRAEEDAKKYLSEKQKLEKEKEVIRIELNALRKEKKELKEALKMTAGMKVKA
LEEKISVLDEKCKLKEKERVDLELILTEVKENLKKSLAGGPALGLAADNKPESSASATHS
DHASPEGLLPLPVNCASEMRKRASSIVTSCKGNVLQKAKEWEMKKT
Download sequence
Identical sequences H3A751
ENSLACP00000005472 ENSLACP00000005472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]