SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005489 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005489
Domain Number 1 Region: 128-292
Classification Level Classification E-value
Superfamily RUN domain-like 3.4e-47
Family RUN domain 0.000000254
Further Details:      
 
Domain Number 2 Region: 655-720
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000005489
Domain Number - Region: 332-380
Classification Level Classification E-value
Superfamily Prefoldin 0.00497
Family Prefoldin 0.0096
Further Details:      
 
Domain Number - Region: 484-671
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005489   Gene: ENSLACG00000004882   Transcript: ENSLACT00000005537
Sequence length 725
Comment pep:novel scaffold:LatCha1:JH128201.1:148056:186163:-1 gene:ENSLACG00000004882 transcript:ENSLACT00000005537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARSRSQARPKLTRGTAKMAAASAGDSVGETELLERLGSAGQAEEAREEFEVIDRSHIPSE
ALSEPAFGPGKDRGAGESPRWSAPIFSLARKASESLSVSIAPLSRAAARAGAAGESPEKP
GVKDHVIVERSNLMNMMKLSIKVLIQSALSLGRTLDSDYPPLQQFFVVLEQCLKHGLKVK
KSFMGHNKSFFGPLELVEKLCPEASDLAVSARDLPELRTSVGRGRAWLHLALMQKKLADY
LKVLIDRKDLLSEFYEPGALMMEDDGAVMVGLLVGLHVIDANLCLKGEDLDSQVGVIDFS
LYLKDIQSMDSSKHDEEMTAILDQKHYMEELNRRLSCTVADLQVKMDSLEKTNSKLMEEL
TAATDRIQSLKEEQQQLAQENASILKNSERRVEVTKQDTRVELETYKQSRQGLDEMYNEV
WRQLKEEKKVRMELERELELQVGLKQEMELAMKLLEKDTHEKQDTLVALRQQLDEVKTLN
LQMANKMQNAEISVQQKNEMIHYLEEKANQTILTIKQMEERLQQSEKARQQAEEKNENTK
QEFKSRIEALQQQFTELNKHCSSLEREVKAEKEQRQNLQRELQRERETAAQMKTQLQQFS
GLQKELEVLQDEKKEFQKVCEDQEQALQEMGLHLSQSKLKMEDIKEVNKALKGHTWLKDD
EATQCKQCQKEFSISRRKHHCRNCGGIFCNSCSSNELALSSNPKPVRVCDICHTFLLQRC
TSTSS
Download sequence
Identical sequences H3A768
ENSLACP00000005489 ENSLACP00000005489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]