SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006522 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006522
Domain Number 1 Region: 15-189
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-38
Family RUN domain 0.00082
Further Details:      
 
Domain Number 2 Region: 534-640
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 3 Region: 683-794
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000352
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000006522
Domain Number - Region: 995-1046
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00212
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006522   Gene: ENSLACG00000005780   Transcript: ENSLACT00000006575
Sequence length 1054
Comment pep:novel scaffold:LatCha1:JH129313.1:184704:209540:-1 gene:ENSLACG00000005780 transcript:ENSLACT00000006575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSTNTSENGFDPKEAKQWIKNQLASSLKALQKRYVTSDTVVTSEDRDANSLCCVLEAVF
IHGLKTKYIKSDVGGKGKKRMGWAPLPQPVFWALLKSITHRDVITELEHLNFINSDVGRC
RAWVRLAVNDSLMECYLTTLLREKSLLCEFYQLTAFLLDSEECEVLLSYLQGLTSLMFHL
SYKSAVLNEWTTTPLALAGLCPGTDLEPHVKSGSSSYRKESFDSSSQSSESEIIEVHHSR
AHSVIHDKKNAEKSNLTSSMLSLDTTSSSQLSSSISSDSLLQANDAKSPDKCTEESWSCD
FDVGMMGAEDSSRSSQEILDEFSRSTHTPDSEKEDSAMQCDPEELQGDLEKLDIQSNTLQ
PVDSPELMVHCTNKSTQGWDAESSKPNQNQVILPQLLELSQDKPKTPSDQSIHAIKCDVI
AQTKKTAVYEGSNSGGIKKEQGENESLGDSAPTSPEFFPKSSNWISEEDFYKPYPKAEII
KEEQMGTVTNKLLCNGNGTVSMMNTIPSKVAHKPSPDREQKNFSVVHRRQIGLSNPFRGL
LKLGNLEKRGAMGIWKEFYCELTPYEFRLCLDSEDRVCSENCSLLKCESVGPAHSDGRFE
LHLLTGKKVHLRAPSQDEADDWVDRLREAVNKCRPQKNENWEILQVPNSSEEVDPSLQGS
HSNEPLPYDALDWSHQTDADLDAIKESVLYTCTENKVWTPFVFSLSLEALKCYRIRDQEK
VLCNIHKIKTIRDVIPDTSLGSLAYFRVLTSKTTLKLQAENAEEAKSWRVLIRKVLTSYL
ETAEDPESTVSQDGSCRKFLEHSLQGDGLFLQYLTVVPRERGLDAQGFKCAGCFKLIGVS
FCKPKLCAFSGLYYCDMCQGTESAVIPARILHSWDLTRRPICKQALKFLHRIQNEPLISV
ESVNQSLYKHVEQMAQIHRSREKLKLLGEYLVTCRSGAIKTLHKCLQDRTFLLESPHLYS
VVDIWQVADGTFEAFLQAAILFATDHVYYCDLCTQRGFICQLCNRSDIIFPFQFETTIRC
KKCKMVFHSLCMPEVFSCPRCVRRQKYLERELQE
Download sequence
Identical sequences H3AA51
ENSLACP00000006522 ENSLACP00000006522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]