SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007250 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007250
Domain Number 1 Region: 61-197
Classification Level Classification E-value
Superfamily PH domain-like 6.61e-23
Family Phosphotyrosine-binding domain (PTB) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007250   Gene: ENSLACG00000006430   Transcript: ENSLACT00000007310
Sequence length 197
Comment pep:novel scaffold:LatCha1:JH127111.1:217763:218687:1 gene:ENSLACG00000006430 transcript:ENSLACT00000007310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARACFIARVPGSDLHMTKDKEEKDRGQKKKRRRRDSSMSFSNFHLVQTIKNSPAVIRRK
FSKDKTKSLSHGDPYFKVHYLGVEKIYSLQVEQTQEIVKSFLQSYQEKGCKDHALVVRPR
YLEVKEIVTGRQLTKTYLHDIAYCTADSVHPNIFLYICKRKGQLQCRVFLCNKAEKAKAI
TGCLAKSFERAFTDWQE
Download sequence
Identical sequences H3AC79
ENSLACP00000007250 ENSLACP00000007250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]