SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007268 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007268
Domain Number 1 Region: 664-748
Classification Level Classification E-value
Superfamily DEATH domain 1.1e-23
Family DEATH domain, DD 0.0000411
Further Details:      
 
Domain Number 2 Region: 62-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000628
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000948
Family I set domains 0.028
Further Details:      
 
Domain Number 4 Region: 116-170
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000115
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007268   Gene: ENSLACG00000006447   Transcript: ENSLACT00000007328
Sequence length 754
Comment pep:novel scaffold:LatCha1:JH128871.1:218588:294321:-1 gene:ENSLACG00000006447 transcript:ENSLACT00000007328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVEWLKNEEVVDPVEDRNFYITIDHNLIIKQARLSDTANYTCIAKNIVAKRRSTTATVIV
YVNGGWSTWTEWSACNSRCGRGYQKRTRTCTNPAPLNGGAFCEGPSSQKNTCSTMCPMDG
GWTNWSKWSTCGTECTHWRRRECTAPAPKNGGKHCDGHALQSKNCTDGLCMQIYIYRTFS
PQQKPENDYGFPSAPSSDDVALYVGIVIAVIVCLVISVIVALFVYRKNHRDFDSDIIDSS
ALNGGFQPVSIKTARQDLLAVPPDLTSAAAMYRGPVYALHDVADKIPMTNSPLLDPLPNL
KIKVYNSSGAVTPQDDLSDFTSKLSPQITQSLLDNETVSLKNQSLARQRDPSCTAFGTFN
SLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPVEDNQTLLSPVVSCGPP
GALLTRPTILTMHHCAEPNTEDWKIQLKSQAAQGQWEDVVVVGEENFTTPCYIQLDPEAC
HVLTETLGTYTLVGQSATKSAAKRLKLAIFGPMSCTSLEYDIRVYCLDDTQDALKEVLQM
EKQKGGELLDEPKTLHFKGSTHNLRLSIHDIPHSLWKSKLLAKYQEIPFYHIWSGGQKNL
QCTFTLERFSLTTTELVCKLCVRQVEGEGQIFQLHCTVSEEPQGIDICLLDPVGSITTLV
GPSAFRIPLSIRQKLCGSLDAPQTRGYDWRMLAHKLKLDRYLNYFATKSSPTGVILDLWE
AQNYPDGNLSTLATVLEEMGRHETVVSLATEGKH
Download sequence
Identical sequences H3AC97
ENSLACP00000007268 ENSLACP00000007268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]