SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007576 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007576
Domain Number 1 Region: 505-605
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-25
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000007576
Domain Number - Region: 76-168,505-525
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0136
Family BAR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007576   Gene: ENSLACG00000006714   Transcript: ENSLACT00000007640
Sequence length 606
Comment pep:novel scaffold:LatCha1:JH127533.1:232389:258819:-1 gene:ENSLACG00000006714 transcript:ENSLACT00000007640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESDASGLEEERRRVLSRISWEEKRITELQQQKEELMMEMEMEVALLEAELQMEREALQQE
EGLIVELKKRHADVELKHQADKEKSAEALEVAVKAFEDLEFQHLEKESSMEEERETLLRQ
ISSEIAEHQQTVARRKERVLKLKEEVTKMREQTEAQRRRLSEAKSESVKILNAEKGRLLG
LPARYSKETGAKSFPDTLQALGKIFLKFWEGVVTAALPAERSNFYCTPSSSQNLSPMKKG
RAQMLMDSEKLTGSAPCVLAATTLSILNSQKPLTFTPFSSLSPPPRAPLLKGTALVVCED
GRVEIVQMRTPTVQSPCMRMVRRIGLLGSSGKPPLAASFLLHEYHESRTRALPALQDFHF
YFVLSSSLSCRRELVATADTPPPTKHPPNKVSSHNGSPGPDIAEIERQLREAIAEKERLL
KDRRRLIELKRQAQRDAKRKELTPQQDKPVPSQAVELRHEERNTQEGPSAPHPAFSCVTF
DLKSHLDSLGHAVETCPHVTILGTSCKGFLTKMGGKIKTWKKRWFVFDGKKRRLAYYADK
EETKLKGVIYFQAIEEIYYDHLRSAFKSPNPKLTFCVKTYDRLFYMMAPTDVAMRIWMDV
IVTAAD
Download sequence
Identical sequences H3AD55
ENSLACP00000007576 ENSLACP00000007576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]