SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007647 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007647
Domain Number 1 Region: 130-189
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000007647
Domain Number - Region: 170-178,210-229,379-430
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00018
Family Cytochrome c3-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007647   Gene: ENSLACG00000006776   Transcript: ENSLACT00000007711
Sequence length 450
Comment pep:novel scaffold:LatCha1:JH127067.1:237976:279855:-1 gene:ENSLACG00000006776 transcript:ENSLACT00000007711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYDEKLARFRQGHLNPFNRESTREDPTQADGDLSQNDSPQIALPVEPSKLEIHSSDRVM
DLGLAEDHFSRPVGLFLVSDVNQLKQAIEECKRQILELPEHSEQQKDAVVKLIHLRLKLQ
ELEDPDEDEPNVRLLQEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYYRCHSKC
LNLITKSCVKSKVSHQSEYELNICPESGLDSQDYRCAECRTLISLRGVPSEARQCDYTGQ
YYCPNCHWNDTDVIPARAIHNWDFEPRKVCRSSMRYLALMMSRPVLKLRDLNPLLFNYVE
ELMEIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHFVENDDMYSLQDLLDLSSGKL
SCSLTEIHTTFAKHIKLDCEKCQAKGFMCELCKEGDILFPFDSHSSVCSDCSAVFHRDCY
YDNSTACPRCMRLQTRKQSLFQPASPSGLQ
Download sequence
Identical sequences H3ADC6
ENSLACP00000007647 ENSLACP00000007647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]