SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007777 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007777
Domain Number 1 Region: 25-101
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000612
Family DEATH effector domain, DED 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007777   Gene: ENSLACG00000006887   Transcript: ENSLACT00000007843
Sequence length 354
Comment pep:novel scaffold:LatCha1:JH127671.1:242525:276023:1 gene:ENSLACG00000006887 transcript:ENSLACT00000007843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVKRSHGQQWPEDEGNEEHGLYSLHKMFEIVGTHLTHRDVRVLSFLFVDVIDDYERGM
IKNGRDFFLALERQGRCDETNFRQVLQLLRIITRHDLLPYVTLKRRKAVCPDLVDKYLEE
TSVRYVTPRSQASDSGPMDTQQPATIAPSHPVICCSSSGPQVCTKRPGRGRLSSSNQKKK
KKSQTMDPKDKQTCGKKNRMPEMQDHWKRLKISFKKAQQTSHNYVTTYIDIRLRVRAEYC
QHETALQGNVFSNKQDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYI
NGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEDDYEAGRQKLLQNLMMQPSP
Download sequence
Identical sequences H3ADQ6
ENSLACP00000007777 ENSLACP00000007777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]