SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010108 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010108
Domain Number 1 Region: 135-330
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.000000764
Further Details:      
 
Domain Number 2 Region: 68-129
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.33e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010108   Gene: ENSLACG00000008910   Transcript: ENSLACT00000010185
Sequence length 330
Comment pep:novel scaffold:LatCha1:JH126829.1:379793:407483:-1 gene:ENSLACG00000008910 transcript:ENSLACT00000010185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAKGSESCSEMQVVPLVGLKPAERGQAPDLLAMALRVKTGGLWRPLKMLACSQLKPLAR
KASLKDGERHLQSERAHNFKVHTFRGPHWCRCCASFMWGFITQGVKCTDCGINAHKQCAK
LVPHDCQLDSRQLQKVYGCDLTALLKAQATQRPLVVEACIHEIETRGLRCEGLYRVSGSS
DQIEALKTAFETAGVDASQAVKGCEDVHTVSGALKLYLRTLPAPLITYSTYYRFIEAVKV
PCPEEQSVRLHNLLEYLPPAHLETLRYLIAHLRRVTHYEKDNLMTAENLGIVFGPTLMRP
PGHDPLAVLNDVCYQRLVVQHLIQHEGVLF
Download sequence
Identical sequences H3AKD7
ENSLACP00000010108 ENSLACP00000010108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]