SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000011287 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000011287
Domain Number 1 Region: 339-468
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-25
Family Ran-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000011287   Gene: ENSLACG00000009930   Transcript: ENSLACT00000011372
Sequence length 469
Comment pep:novel scaffold:LatCha1:JH126738.1:459616:495668:-1 gene:ENSLACG00000009930 transcript:ENSLACT00000011372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKRIADKELTDRNWFQEDEVEEAGTFSVASEDVLKSRTIKKAKRGNVGAEAENSSAFKG
FKGLVVPSGSKTGFSGFGNGFGLKSLQGVSNGNGGSSGPSPFTGFKASESNIGVFGSDSS
ALGFFQKKDAATKLNGKNEASHSSSTPPLSRTCGNSTEYNKQLTALNCSVRDWIQKHVNE
NPLCDLTPIFRDYEKHLASIEQKYGSSSDSGSESDTSGKKIETPSALTLGALPQQVPAAS
TPLFSFTSKKESIPDKMAKLSRTASEFAGGIGKKGNSGLRSLGSGAVPSFSFSSGGSSSL
FGKDPNQVKPVATSFSFTSSESKPKGETQEETKGDPEDKDEESEEPPKNVVNEIKEDDAF
YSKKCKLFYKKDNEFKEKGVGMLHLKPVDKKTQLLVRADTNLGNILLNIFVQPSMPCTRT
GKNNILIVCVPNPAVDEKNPTIPVPVLIRVKTSDDADELHKILLEKKEA
Download sequence
Identical sequences H3ANR6
ENSLACP00000011287 ENSLACP00000011287 XP_005993728.1.90931 XP_014342537.1.90931 XP_014342538.1.90931 XP_014342539.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]