SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000011603 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000011603
Domain Number 1 Region: 8-390
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-98
Family Ras GEF 0.00054
Further Details:      
 
Domain Number 2 Region: 452-520
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 384-456
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000045
Family Calmodulin-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000011603
Domain Number - Region: 669-708
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0144
Family Moesin tail domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000011603   Gene: ENSLACG00000010211   Transcript: ENSLACT00000011692
Sequence length 719
Comment pep:novel scaffold:LatCha1:JH126706.1:481877:547071:1 gene:ENSLACG00000010211 transcript:ENSLACT00000011692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DADGNLCRSNHLLQVVLTMHRFIISSSDLLQKLIKLYTNALEKNSIGVCQRICYLVRYWT
TEYWVMFKMDSSLTEAMEHFQELVRRNGDESHCCLIDTTQINARDWSRKITQRIKPNSSK
KRKVSLLFDHLEPDELAEHLTYLEFKSFRRISFSDYQNYVVNGCVKDNPTMERSIALCNG
ISQWVQLMVLNKPTPQLRAEVFTKFIFVAQKLHQLQNFNTLMAVVGGLCHSSISRLKETS
SYVSNEVHKVLNEMTELLSSCRNYDSYRRTYSECSSFKIPILGVHLKDLISVYEAMADYL
EDKKINVHKLQVLFNHINELIQLQQVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAR
EPRNNRVPPATPSKPPVVADWASGVAPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQD
EFEKIAASFPFSFCIMDKDREGLISRDEITAYFMRASSIYSKSGLGFPHSFQETTYLKPT
FCDNCAGFLWGVIKQGYRCRDCGMNCHKQCKDLVVFECKKKLKSTLVDNSPMPGSTPSAL
CPAGVKGQSQGADEGPFMFPNGEMANEHTEESKDRTIVLMGGSAQKISLRLKPTVVHKST
QTDTEISNGSTPTGLFPLASPRSKASDSVLLIPSPTSPCPSPVLVRKRAYAKWENRASTF
KPREEQNCKPTLHQIEKENSNLREENEALQRKLKEAQREIEALRIKLQRFENKEQRDSP
Download sequence
Identical sequences H3APN2
ENSLACP00000011603 ENSLACP00000011603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]