SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000011653 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000011653
Domain Number 1 Region: 262-307
Classification Level Classification E-value
Superfamily PH domain-like 0.000000216
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000011653   Gene: ENSLACG00000010256   Transcript: ENSLACT00000011742
Sequence length 309
Comment pep:novel scaffold:LatCha1:JH127351.1:486418:512807:1 gene:ENSLACG00000010256 transcript:ENSLACT00000011742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNEINLQQTVIHQASQALNCCIDEEHGKGSQEEAEAERLLLIATEKRVAALAELNKLKSE
GTAGQKNGAPIEFSPSRGSVALLEMRMPLKADFICSTAHKTDAANYYFFVMIRAGAENMV
ATPLACTQNSLSGDALSFPTKFTLQDVSSDFEIDVEVYSLSRVILKPPLMISGLLNTVIN
LSPKLEAITPKRLLTSITQKSNLHTPALASPGGPNAVRTSNFVLVGSHKLNLASVGKSKF
TLDKVPFLSPLEGHIYLKLQCQINSSVEEKGFLTMFEDVSGFGAWHRRWCVLSGYCISYW
TYPDDEKRK
Download sequence
Identical sequences H3APT2
ENSLACP00000011653 ENSLACP00000011653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]