SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000012047 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000012047
Domain Number 1 Region: 335-597
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.21e-72
Family Nuclear receptor ligand-binding domain 0.000000000163
Further Details:      
 
Domain Number 2 Region: 262-340
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000012047   Gene: ENSLACG00000010606   Transcript: ENSLACT00000012139
Sequence length 599
Comment pep:novel scaffold:LatCha1:JH127246.1:517937:525607:-1 gene:ENSLACG00000010606 transcript:ENSLACT00000012139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGTSPQGASPASQSYSYHTSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTSYDVKPPCLYQMPLSGQQSSIKVEDIQMHGYHQQSHLPPQSDEMMSHSGSV
YYKPSSSPTPTTAGFQVQPSPMWDEPSSLHNFHQNFVATTHMIDQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFEGPLHVSMNPETSGAHHVVDSQSFAVPNPIRKQASMGFPHGLQIGH
GSQLMDNQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVC
LANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPS
PPVNLISALVRAHVDSNPAMTSLDYSRFQANPDYQISGDDTQHIQQFYDLLTGSMEIIRG
WAEKIPGFPDLPKQDQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGF
GEWIDSIVDFSSNLQSLSIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHV
AFNSGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences H3AQX6
XP_006001350.1.90931 ENSLACP00000012047 ENSLACP00000012047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]