SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000012384 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000012384
Domain Number 1 Region: 50-266
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.36e-33
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000012384   Gene: ENSLACG00000010905   Transcript: ENSLACT00000012477
Sequence length 268
Comment pep:novel scaffold:LatCha1:JH127765.1:545448:575426:-1 gene:ENSLACG00000010905 transcript:ENSLACT00000012477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHWRLAVLLATLFTLANLQEEEEEDGGWLTSRYIALTGEGPCNVEVKNSTLTYSEFIQK
FAFSRPVVIRGITNNSEFQRLCSKRHLLEQHGDQMVRLSTANTYSYQKVDVPFREYVDHL
LKPQSMETLGSDTLYFFGDNNFTEWGPLFQKYIAPPYGLPGTSEAYSFGIAGAGTGVPFH
WHGPGYSEVIYGRKPFKRWFLYPPDKAPEFHPNKTTLSWALDTYPILSEEDKPIECTIHP
GEVLYFPDRWWHATLNLDTSVFISTFLG
Download sequence
Identical sequences H3ARW3
ENSLACP00000012384 ENSLACP00000012384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]