SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014955 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000014955
Domain Number 1 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 125-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000484
Family Hairy Orange domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014955   Gene: ENSLACG00000013163   Transcript: ENSLACT00000015060
Sequence length 414
Comment pep:novel scaffold:LatCha1:JH127283.1:817147:822928:1 gene:ENSLACG00000013163 transcript:ENSLACT00000015060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGISRLQERQLLEHADFIGVEYPSLFMCKPKRGIKRDDSKEAYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGDQNM
KSPIQSDLDVFHSGFQTCAKEVLQYLSRFENWTPREQRTVQLINHLHTVSTQVLSNSQVL
TPQISACTSGQKHNNQNLEVQKNCVPVIQRTHNVELNENDTDTDSGYGGEVEKSEGKIER
EYNANKNNEMKNISIKQEPSEDPPTKKMKADISGNLPINFDHTSRPDTSIINSLMGFGNL
PFGQQAPFCLPFCFISPSTAAAYMPFLDKGITEKFFYPTATPIPLLYPGIPAQAAAAFSS
VLTPEKLCAASAVLSQSAPSPSQCFATPSASDTGRNVDSECPTQEPLKTGNSNP
Download sequence
Identical sequences H3AZ84
ENSLACP00000014955 ENSLACP00000014955 XP_006001768.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]