SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014984 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000014984
Domain Number 1 Region: 111-269
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-23
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 358-446
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-19
Family Pleckstrin-homology domain (PH domain) 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014984   Gene: ENSLACG00000013188   Transcript: ENSLACT00000015089
Sequence length 799
Comment pep:novel scaffold:LatCha1:JH127417.1:820713:909667:-1 gene:ENSLACG00000013188 transcript:ENSLACT00000015089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVGQLLAELEEFLKILDRENLSSTALERKCLLSDLLQTYTKSNGCDEEYIYMNKVIFIKQ
QQGQEKPSSDGVPDHIYCLTNGDLGKHSPAPQKSLPDLPLPRIVKNIDRQQCPLPKTESP
DGYYEEAEPYSTTTFDDGEAVSSSYESYDEEESSKGKCTTHQWPSTEASIELMKDARICA
FLWRKKWLGQWAKQLCVIKDNRLLCYKSSKEQHAQLDVNLVGCSVVYKEKQMKKKEHKLK
ITPVNADDIVLGMQSKEQTEQWLKVIQEMSNIHPESISDGTQATQDTSRQSCTKTDLSER
GSAASESGSSTDGHSESIDTKDVKKKSSTGLKLSTLMNLGRKKSSFLESPERTLLEPSGY
LNVLVNSQWRSRWCQLKEGRLYFYQDKSKTKMIQQTVALEGCDIISDPSPEHLYSFRILH
SEEEVAKLEAKSSDEMGHWLGLLLSESGSKTTPEELVYDYVDADRISSIVNAARTSLYLM
QRKRSEPNTYIDSLPVAQNQSDDLYDDVDVSDQVVRFHEENLKEEVKPKEAEDRIYLDLI
PAKSLFSNDKQSSTTPSSSPLLQRSSTNPVEETSTKDTNVGLEQEPLFQHTLDTEDFIPK
TVIKIQTHQQKITFPQGDFNKKTPTNNPQPYKDYLSTSLIEAKLGKSRTEADIKIFSEEK
ERLEKEKENIRQELAQLRKEKREVKEAISTCTEKSTLSLLEEKLKQIDEDCKQKENIRVD
LELELVEAKENLKKAESGPVMLGTTVEAFHFETPTSNVKATSLISSPETSPAVNSATALK
NRPVSIMVAGKGTVLQKAK
Download sequence
Identical sequences H3AZB3
ENSLACP00000014984 ENSLACP00000014984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]