SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015300 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015300
Domain Number 1 Region: 408-514
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-21
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015300   Gene: ENSLACG00000013468   Transcript: ENSLACT00000015406
Sequence length 528
Comment pep:novel scaffold:LatCha1:JH126572.1:862935:919371:-1 gene:ENSLACG00000013468 transcript:ENSLACT00000015406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEKAKDCLTYLVNQLANMEHSFHHILLLQIKSITDAFSNILGTQSKDIYRMSNSFTATAK
LLVRQLEKENTANSREENDSETSTSQSAELKSAATDPTEDEKLQVKIQAFEDKISIENGT
PCPIRRYSLGQASKEERKEMRFNRSKSLALHAVRTKSLSSDNGQDMENGEIMADISLSET
SLSQESDKLPLEVDSEDSKAEIHLISHPTVTHIENSSQLVTENSHDSCVETIPGSVEHKD
QLYLHLKENLNNVKAYFSETVKRVPVPEQCVIEDAIRCCVTKLFFSCPMKGHYCLYSKSS
FTLNSWQPQVWIRIMFLSQQSLFSEPLSVEDISVQSLKALWEKAQLKGTHSFETAMIQTL
FPSKKDLDRILVHLEEVRFFDLFGYNEETGSWQCFMCNNPEKATVVNQEGQPLIEGKLKE
KQVRWKFIKRWKTRYFTLAGNQLLFRKGKSKDGLGDCPIELSKVQSVKAVAKKRRDRGLP
RAFEIFTDSKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREATTYL
Download sequence
Identical sequences H3B079
ENSLACP00000015300 ENSLACP00000015300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]