SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015517 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015517
Domain Number 1 Region: 38-332
Classification Level Classification E-value
Superfamily L domain-like 2.3e-59
Family Ngr ectodomain-like 0.004
Further Details:      
 
Domain Number 2 Region: 434-501
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000765
Family Fibronectin type III 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015517   Gene: ENSLACG00000013661   Transcript: ENSLACT00000015625
Sequence length 640
Comment pep:novel scaffold:LatCha1:JH127309.1:891810:906035:-1 gene:ENSLACG00000013661 transcript:ENSLACT00000015625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETAFTFHGLTYICIRLLLLLLLLPLLWGLILALGDSCPAQCTCTYLQAHVDCAGMNLAAI
PPNIPGNATVVYLSNNSFPTVAAGSFTDLSNLTALHLSSCHVSKIQGAAFAGLPSLQHVH
LDHNNIEELGSDVFENATSLRYLYLDHNKITQLNPGTFTSLTSLNALYLNSNLLTQLAPL
TFKGLGRVRLLDLSHNHIFNISSLVFTSLRSIRNVHLQGNNLTNVPKSLRYRRSLSVLNL
SENPIRELTHNSFGSRLRSLLELYIDNTGLEQIAPSTFFKFRQLKVLSLRDNRLQSLPPL
KALRYLKEVILAGNPWRCDCNLLWLHAWYKQQPTINVDHQANCSTPAALEGQPLAKVQLQ
KLSCPPYNPNTPTTQPPQQLSSHDQVQPTKGVSRLTTRKATTTTTTKATTTTKKQVRTVH
SPVDNKQDPCLSDQVYGVAASAKDDGSLTVTWSFFGDYSQFEVRYSHDDTVQVSRTTGGV
TEAELGNLVTNALYRICIVPQKYATKCLKPVDRQCTEKLMEGSSGESPQEHSSGSGLGIG
ITAAVMLLAVLGLVAFRKLKDRAFRFQRHYDEDGLDGAEQFGGDAPKLDTDPVYENIADG
TQDYGSLPSETPKTEENKVSLKWGLDTMANIPSTPRYVNI
Download sequence
Identical sequences H3B0U6
ENSLACP00000015517 ENSLACP00000015517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]