SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015582 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015582
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.66e-58
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000672
Further Details:      
 
Domain Number 2 Region: 167-198
Classification Level Classification E-value
Superfamily E set domains 0.00000000077
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015582   Gene: ENSLACG00000013719   Transcript: ENSLACT00000015690
Sequence length 203
Comment pep:novel scaffold:LatCha1:JH127364.1:900224:913224:1 gene:ENSLACG00000013719 transcript:ENSLACT00000015690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PYVEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYPTIKIHNYQGPIRARISLVT
KDPPHAPHPHELVGKDCKDGYHEADLTGERSVYRFFSLSLFLREREPLSSLSGRVSVPKE
DVTKNIEYDLNAVRLCFQVFIRDQMNQLIPLQPVVSHPIFDSRAPNTAELKICRVNKNSG
SCKGGDEIFLLCDKVQKGKLFRK
Download sequence
Identical sequences H3B111
ENSLACP00000015582 ENSLACP00000015582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]