SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016108 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016108
Domain Number 1 Region: 2012-2168
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000307
Further Details:      
 
Domain Number 2 Region: 1859-2012
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.76e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000311
Further Details:      
 
Domain Number 3 Region: 21-207
Classification Level Classification E-value
Superfamily Cupredoxins 3.67e-47
Family Multidomain cupredoxins 0.0000232
Further Details:      
 
Domain Number 4 Region: 1714-1858
Classification Level Classification E-value
Superfamily Cupredoxins 3.61e-41
Family Multidomain cupredoxins 0.0000637
Further Details:      
 
Domain Number 5 Region: 397-582
Classification Level Classification E-value
Superfamily Cupredoxins 4.85e-41
Family Multidomain cupredoxins 0.0000401
Further Details:      
 
Domain Number 6 Region: 1560-1702
Classification Level Classification E-value
Superfamily Cupredoxins 8.09e-39
Family Multidomain cupredoxins 0.000063
Further Details:      
 
Domain Number 7 Region: 587-700,751-767
Classification Level Classification E-value
Superfamily Cupredoxins 1.13e-28
Family Multidomain cupredoxins 0.00032
Further Details:      
 
Domain Number 8 Region: 216-351
Classification Level Classification E-value
Superfamily Cupredoxins 1.79e-28
Family Multidomain cupredoxins 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016108   Gene: ENSLACG00000014186   Transcript: ENSLACT00000016219
Sequence length 2173
Comment pep:novel scaffold:LatCha1:JH126781.1:980017:1034420:-1 gene:ENSLACG00000014186 transcript:ENSLACT00000016219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMRHWTFCFLYIFHHYVESLETTREYYIAAVELDWDYTHSNFLAALLSQDRVQNVNPQSK
DPGEPTIYKKAVYLEYTDSSFSEPKQRSSWMGLLGPTIRAEVFEKVIVHFKNLASHPFSI
HPIGISYWKTAEGAGYDDETSPSEKEDDAVQPGASYTYIWDINKEMGPTEVGFHCLTYSY
SSHVDTVKDFNSGLIGALIICNAGVLTSEGTQLGIQEFVLLFSVFDESKSWYSQQDKTGD
QVHTLRTSTKQNLHTINGYVNSTLPDLKLCQKKPVRWHVMGMGTTPKVHSIHIREHAFLV
RGHKQVSFKITPMTLFTAEMTANVIGSFPISCQIPDQQHASMNAYFTVENCPEILKKDMK
AEGEEYNGDFDYVSWDMEDINDKGPEPVKRIYAKEYPITWPYYIAAKEVEWDYAPKIPDD
MDSNYTAMYLEVGPQRIGKRYKKVIYVACTDSTFKKCSDVNGSTTGILGPVLRGEVGDTF
KIVFKNLASRPYNIFPYGLAVKLYYENTIIPLGLDLKEVAVQPNQGITYLWTITSQDGPT
KTDPHCLTRFYYSSIDPIRDVASGLMGPLVVCSKETIDFRGNLVKTDKDKFLFFSVLDEN
KSWYLTENVQKYCKAPSTVNPEDPTFYDSNVMHSINGYAFGNLLMKFHQDEVAFWHLLSI
GSQTDVLPIYFSGNTYEQNHIYSDAVTLFPFSGETVYMQMKMQEINLHNIDYSVTLFCSG
KISIGNVSPATEYSISVIKKDSRLVTLENLVNKVTFFFNCRLPNHYEYNLQTNKKILVLN
LQGCWQLHLPKSSKEFFSRIIRLLNRRERKSGFFLFYFKQAKPIWVPVEVGEVQHPGAAI
SAAPPTQRGNPRSFFLIFQLSFCIEGDENKYFCFLLKKLICSLCECVCFFSSILGLWHLG
SLIPYFKDRGMIAMYEVSSKENILQDDYYDYHIGYYAETQEIVSPRSFFRNKKRPRNHPC
RNQDLNTTTDLSENATGNVRNLFFCRRFFRHLEWVRKQRGDLVNQNNNSEGLSKNSDPDV
VDPVSLDVLGYILNDPPNLKERIHIEQSLEEEHEWVQNVAQTSNYTTNKQAIHETESSNY
QKDDPQLSTVTNASQAGSERQLGVNSKDSETMILNLESHEDLSVELSEASKKGMSIQEAI
ALASEETSLVDNGSQLDLNKTSDYNKDQSVFTGCGSNEHKCSKHHEKRSLETIADNSMHK
VVEPEMDNSLKEQYEITGRIKENRMFKRDVPASVAKINQTAIKEGKPFSSKHRRYISDSQ
PSRQNKTDVWPAISTTHKWLRNITQQFNHKDQLHQEEINNSYVLQNSTDDYDFEINQHEA
EDIEIYDEYETGDIYTRDCKNVRSYFIAAKEMPWDYGIKETEQFLKPSATRPSGKLFLFT
LMISLKQHTCLTKKVSKVFPYSPILLSKYCMWLKLPRSDIATRQSLKLSVVAVYCSLKSK
FESENPKLLKKLEYEMNLIWEEKTSLYLTMVCHLWANRFHQTNYNSNEPIDKIYVELIEM
SKCKYSRDRYRYRYIDKETGKVYNPLKYISPLSYWFERNLHFCVTIIEMLKDAFFSIRRQ
TEGWQYKKVVFREYTDQRFIKPMARGEWDQHLGILGPVIRAEVNDIVTVTFKNLASRPYS
FYTHILPPEMAFKEKTYNSRTVEDYAVQPNEIRKYSWMVPPRIGPTDKESDCKTWAYYSN
ISLEKDIHSGLIGPLLICKQNTSSLRFRRQPNIQEFSLLFMIFDETKSWYQEENYEGNCK
PPCQLKWDDPAFQSSNMFHAINGYVAETLPGLVMAQKQLVRWHLLNMGGSDDIHAVHFHG
QLFTVRGDQDYRMGILNLYPGTFRTVEMLPMKAGRWLIDSEIGEHQQAGMRAHMLVYNPD
CHEPLGLASGKIKDSQITASGHSGGWQPRQARLDNEGNYNAWSFHGRKSWIQVDLKRTMI
ISGIITQGAREWFSSLFVSYYIISYSSDAKIWTGYRGNATSLQMMFRANVDATSHKQNLF
NPPIVARYIRVHPTWYSGRPTLRMELIGCDINSCSIPLGMQDKTIQNHQIQASSFYSSWF
SEWSPSLARLNLQGRINAWRPKVNNQDQWLQVHFQEVMKITGIITQGAVHNFVVSMYVKE
FALSTSLDGDQWTVLQEGGKEKVFQGNTNAKEHVMNSIDTPLFTRYVRIHPRSWKNDIAL
RVEFLGCKTQQRQ
Download sequence
Identical sequences H3B2I7
ENSLACP00000016108 ENSLACP00000016108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]