SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017054 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017054
Domain Number 1 Region: 147-395
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-56
Family Nuclear receptor ligand-binding domain 0.0000000171
Further Details:      
 
Domain Number 2 Region: 38-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000703
Family Nuclear receptor 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017054   Gene: ENSLACG00000015024   Transcript: ENSLACT00000017177
Sequence length 412
Comment pep:novel scaffold:LatCha1:JH126641.1:1156702:1201767:-1 gene:ENSLACG00000015024 transcript:ENSLACT00000017177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THPSLDKPKGSPTVLKFSCSLENGREHGFPVDYFFPPQKSCLICGDEASGCHYGALTCGS
CKVFFKRAAEGKKATVLCVKHTNARVDEIKKRNNPSARFRSDFNMAAIWNARKLKKLGQL
KMQEESGTLNPGKMEPGQNTLLGFGIPRMESFQTQPLFLNILEVIEPIVVFAGHDNSQPD
TAACLLTSLNELGERQLVHVVKWAKALPEGFRNLNVEDQMTLIQYSWMGIMVLAMVWRSY
KNVNARMLYFAPDLVFNEYRMHKSNMYEHCIRMRHISQELVLLQISLEEFLCMKVLMLFS
IVPVEGLKSQNYFDELRLNYIQELDRVIACRTFDPSCSTSCYSSPRERFYQLTKLLDSLE
PVVRKLHQFTFDLFVQARSVSVDFPEMMAEIISVQVPKILSGMARPLLFHKQ
Download sequence
Identical sequences H3B583
ENSLACP00000017054 ENSLACP00000017054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]