SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017222 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017222
Domain Number 1 Region: 185-424
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-72
Family Nuclear receptor ligand-binding domain 0.00000000494
Further Details:      
 
Domain Number 2 Region: 65-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-28
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017222   Gene: ENSLACG00000015170   Transcript: ENSLACT00000017348
Sequence length 426
Comment pep:novel scaffold:LatCha1:JH126644.1:1190737:1199161:1 gene:ENSLACG00000015170 transcript:ENSLACT00000017348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLLQDPSNQEVMLSSVKEEPGRDPSPALQDGVSSPEGEESPAIDPEALPLKRKKGPAP
KMLGNEMCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKDARYSCKNDGKCQMDTYMRRKC
QECRLRKCRQAGMREQCVLSEEQIQRKKMRKQEEETVRASVITQHAPSVLPDPIGTGAMA
AATPLTTEQEKMIQQLVAAQQQCNKRSFSDQPKVTPWPAASDPHSREERQQRFAHFTELA
IISVQEIVDFAKQIPGFLDLSREDQIALLKASTIEIMLLETARRYNDENDCITFLKDFTY
SKEDFQRAGLQVEFINPIFEFSKGMRLLQLDDAEYALLIAINIFSADRPNVQDQELVERL
QLPYVEALHSYTLIKRPQDHLMFPRMLMKLVSLRTLSNAHSEQVFALRLQDKKLPPLLSE
IWDVHE
Download sequence
Identical sequences H3B5Q1
ENSLACP00000017222 ENSLACP00000017222 XP_005990993.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]