SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017638 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017638
Domain Number 1 Region: 466-750
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-62
Family Nuclear receptor ligand-binding domain 0.00000000946
Further Details:      
 
Domain Number 2 Region: 413-491
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-26
Family Nuclear receptor 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017638   Gene: ENSLACG00000015535   Transcript: ENSLACT00000017768
Sequence length 770
Comment pep:novel scaffold:LatCha1:JH126856.1:1274202:1412592:1 gene:ENSLACG00000015535 transcript:ENSLACT00000017768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMESKEVLNTSGGDSLKCVDYSKREEVYDFNPVFRGGAPIPLTPASSLLLVSEADSPRQL
ASGDTSNGVSGNATPQDLSQAVSESMGLYMGESDSKVIGQKARLQKQGQISGLSVETEFA
LLEESIASLNRSTRIGEVSGSLAPGQVSLDNGSGMAKCDLSVEQETFAQTDSDPNGNLSF
FPDDQAAFDILQELDLTPCSPGKENPWSLDPIYDGGGRGLLSPLAADDPFLMAAVANEDC
KSSLVTNTSQSTNNECGNLFIPDLSSQLSQIKSDKEGYIELLTPGVVKQETLGRSYCQAN
LTSAASTTANSSISIHGVNTSGGQMYHYDVNAGAVSSAQQPDQKPIFNFIPPVSTIAENW
NRCQGSGATNSTPPLGNVNASGRSGFASSYPSPGTRTATPTPSSSSTSSGPPHKICLVCS
DEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAG
MNLEARKSKKLNKMKGNLSSKEQATPPLPERAVVPASVPQLTPTMISLLEAIEPSILYSG
YDSTIPDTHCRLMTALNKLGGRQVVAAVKWAKALPGFRSLHLDDQMVLLQYSWMFLMAFG
LGWRSYQQANGSMLCFAPDLIINEQRMQLPYMYEQCQHMLKIASEFSRLQVSYEEYLCMK
ALLLLSTIPQEGLKSQPVFDEIRMTYIKELGKAIVKKEGNSNQNWQRFYQLTKLLDSMHD
VVKELLKICFHTFVDKSLSVEFPEMLAEIISNQLPKVTSGSCKALLFHQN
Download sequence
Identical sequences H3B6W7
XP_005996162.1.90931 XP_005996163.1.90931 XP_014343931.1.90931 ENSLACP00000017638 ENSLACP00000017638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]