SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017771 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017771
Domain Number 1 Region: 616-745
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000102
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 2 Region: 14-49
Classification Level Classification E-value
Superfamily WW domain 0.000000000185
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017771   Gene: ENSLACG00000015650   Transcript: ENSLACT00000017901
Sequence length 1067
Comment pep:novel scaffold:LatCha1:JH126669.1:1319575:1375589:1 gene:ENSLACG00000015650 transcript:ENSLACT00000017901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYTKPLTFADCIGDELPLGWEEAYDPQVGVYYIDHNTKTTHIEDPRVQWRREQERMLKDY
LVVAQDAVTAQKEIYQVKQQRLELAQQEYRQLYEVWKEKSTSQTSLVSGSSSSSKYDPDI
LKAEIATTKSRVYKLKREMTHIKQELQYKEEGFQTLKKIEQKMSGADYKLDEAQAILSEV
KVIKKAISSGEREKRDLLQSLARLKEGFFVDKGSQSDLWASDTSLQRSDPCIARHYSDVG
SQTDLSGNVSTSNINKLAEKVRMRLKYEEAQKRIANIKIQLARLEANIWPGLLDSDRDQL
ILINEKEELLKEMQFINPRKWDQREVERLESERRRLEEDLQAARNTQSKALTERLKLSCK
RNKLVKELEETAQEMATLHTQLKSLSTSTLSLSSDSSRGSLTSSRGSLATSSQGSSTSVS
FTDLYCDQLEQADSDYQYKLDFLLQEGSTGFRPSVSITTIHENEVAKTRNNTDPTSRMQA
LRALSETPKSLTSLSPRSSLSSLSPPCSPLVMDSHLSGDAFLSHTDFEDTELNSNLAELN
LSTGTINCRLQSSEADITPQGGNAGAIQRGAHVSAAVSDESVACDSGVYEACMKRTREFD
LTVFDDDEAGTFGTAQIQIGLQYDDKKKRFKIFVMQLCNVGALTQQQDQKIYVRVAVLPC
SETTSCLFRTESLGPSDTLVYKELFWVSISHSALCRKTLRIDVCSVKQSHHEHCLGGAEI
SLAEVNCSGEKSTCWYNLLADKHLKKQSKKSTGVHASTEASTIESKDSVSVLLAQTAVEL
ETVEKTLPEDGNTLTSENNWYEDDPVGEEDNSSESDAKEEEGEFPEEASWEREEMSAETQ
VDKETNTEGPAQVPSVVRPKDRRSANQPQTTFVRGSTIIRSKTFSPGPQSQYVCLVRKIK
LKSSMSSSMKVPLQNNSSCTGAKTEQKPEKKLKRLRKRRNKSYKISLQVKWEPSSVYQAS
LSAFYSKVKEVTHTQNGQTKYKYYMPVNTSLESRHSLFTRLYSKHADIKEQKRELCAEKV
MKAAAKDVRRLRGRNQKEPLEMQSFREKMVFFTRPRIDIPSLAADDV
Download sequence
Identical sequences H3B7A0
ENSLACP00000017771 ENSLACP00000017771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]