SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018037 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018037
Domain Number 1 Region: 122-336
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.02e-46
Family Tyrosine-dependent oxidoreductases 0.0038
Further Details:      
 
Domain Number 2 Region: 12-49
Classification Level Classification E-value
Superfamily WW domain 0.000000000000195
Family WW domain 0.0011
Further Details:      
 
Domain Number 3 Region: 57-91
Classification Level Classification E-value
Superfamily WW domain 0.00000000016
Family WW domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018037   Gene: ENSLACG00000015893   Transcript: ENSLACT00000018168
Sequence length 353
Comment pep:novel scaffold:LatCha1:JH126961.1:1389676:1401768:-1 gene:ENSLACG00000015893 transcript:ENSLACT00000018168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALKYAGLDDTDSEDELPPGWEERTTKDGWVYYANHVDQKTQWEHPKTGKRKRVAGDLP
YGWEQETDENGQLFFVDHINKRTTYLDPRLAFTVEDNPVKPNIRQRYDGNSTAMEILQGR
DLTGKVAIVTGANSGIGYETARSLALHGAHVILACRNRTRASVAVHQILDEWHKAKVEAM
TLDLAALHSVQQFSEAFKSKNLPLHLLICNAAVFAVPWQLTEDGLESTFQVNHLGHFYLV
QLLQDVLRHSAPSRVIVVSSESHRFTDIKGASEKLDLNLLSPSKREYWAMLAYNRSKLCN
ILFSRELHRRISPHGVMSNALHPGNMMYSSLHRNWWVYTLLFALARPFTKSMG
Download sequence
Identical sequences I6L4Q1
ENSLACP00000018037 ENSLACP00000017019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]