SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018078 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018078
Domain Number 1 Region: 3-42,73-289
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.28e-71
Family PhyH-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018078   Gene: ENSLACG00000015929   Transcript: ENSLACT00000018209
Sequence length 293
Comment pep:novel scaffold:LatCha1:JH126677.1:1401644:1425831:1 gene:ENSLACG00000015929 transcript:ENSLACT00000018209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPILEQQIQQYHRDGYLVLEGFFTLEECDLMRKRIKEVVEEMDVPMHCRTEFSTDEKEQ
LEAQGSADYFMTSGDQVRFFFEKGVFDSKGEFLVQKERSINKIGHALHALDPVFKNITHS
LKVQELVRKLGFQEPVIIQSMYIFKQPGIGGEVTPHQDATFLHTDPLGRVMGLWIALEDA
TEENSCLWFIPASHTGGVTRRMVRTLPGTHPRTEFIGSERSYKENEFVPVPVKKGGLVLI
HGEVVHRSSLNISERSRHVYSFHLMESKNTHWRKENWLQPTPELPFPSLYTSV
Download sequence
Identical sequences H3B857
XP_005992159.1.90931 ENSLACP00000018078 ENSLACP00000018078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]