SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018437 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018437
Domain Number 1 Region: 1623-1778
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.2e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000285
Further Details:      
 
Domain Number 2 Region: 295-473
Classification Level Classification E-value
Superfamily Cupredoxins 2.35e-51
Family Multidomain cupredoxins 0.00000989
Further Details:      
 
Domain Number 3 Region: 1134-1316
Classification Level Classification E-value
Superfamily Cupredoxins 1.22e-48
Family Multidomain cupredoxins 0.0000214
Further Details:      
 
Domain Number 4 Region: 3-147
Classification Level Classification E-value
Superfamily Cupredoxins 5.6e-43
Family Multidomain cupredoxins 0.0000042
Further Details:      
 
Domain Number 5 Region: 1488-1622
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000216
Further Details:      
 
Domain Number 6 Region: 486-624
Classification Level Classification E-value
Superfamily Cupredoxins 4.26e-38
Family Multidomain cupredoxins 0.00019
Further Details:      
 
Domain Number 7 Region: 1325-1465
Classification Level Classification E-value
Superfamily Cupredoxins 2.24e-35
Family Multidomain cupredoxins 0.0000299
Further Details:      
 
Domain Number 8 Region: 150-275
Classification Level Classification E-value
Superfamily Cupredoxins 1.05e-29
Family Multidomain cupredoxins 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018437   Gene: ENSLACG00000016237   Transcript: ENSLACT00000018570
Sequence length 1780
Comment pep:novel scaffold:LatCha1:JH126723.1:1497148:1597884:-1 gene:ENSLACG00000016237 transcript:ENSLACT00000018570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPTYKKVVYREYDENFIQAKEMPKWNGLLGPILRAEVGDTLKVHFRNMADQPYSIHPQGI
AYGKQSEGSSYADETSSLEKKDDSVSPGGEYTYVWAITEDNGPTNADPPCLTYTYYSHVN
LVKDFNSGLIGVLLICKQGSLNEDGTQKLFDRDYVLMFAVFDERKSWHNSVKQGRLIYSV
NGYKNGTVPDFEVCASDKISWHLVGMSSEPELFSIHFNGQVLEQKGHRFATISLITASSA
TANMTVINEGKWLISSLLEKHIKAGMYGYLNVVKCENKEIKTAILPISLKRLKKSWEYFI
AAEEVTWDYAPNIPLYINKEYKSKYLEQGPTRIGKEYKKVVYRQYADKTFRNRTYYNDTE
SGILGPVIRAQIRDKITIVFKNMASRPYSMYPHGLSISKDYEGANYPADSSGKQIQKIEV
KPNETYTYEWVVSENDGPTKDDPRCLTRMYHSAVDVTRDIASGLIGPLLICKIHSLDKRG
FQKRADVEQQVVLSVFDENKSWYIEENIEKFCTSPSSVDKEDPEFYNSNVMHTINGFVYD
SIPVQGFCREQLVYWHVSNVGSMDEIQSLHFNGHTFEHRAKNEDVLKIFPMTGDTVAMEM
DNVGEWLYGSLSSHQKNLGMRLKFMDAVCPSYDSNYDNYNIDMEPSSVIQINYDQRTNQV
PGDKPKKPALPDSETEQWADYLGLRTFSKGTLFAGDEMDPISWGDVDINNTDFNHQKNKS
VDFLNESVDNDTDITTQNSIDTLKDGDQVNDIVEINDFSDFNDKTLNLTEEFMYFNDEEE
NPDHSPVSHNSKLGNTSEENLSNQLDTENNLDIRIQEYFSEELSTLVPDLFTKSPGDDFL
TLTEVEQPRYDPHKMMDFEWLSTALPIETKFKNTSELDDNESLKNDSSLIGNELVPSLIE
NSTVYALNPNAYNSPMDANETNLKSLVQDFISEEDSSSISEEDSDKSSESFGEVHIYLKS
NVSNSTRLKIQTTSLDPVKKQWNYQGREHTVEAKPSQHLTRYTEPFKKINRTKSKLNKTS
SNLATRIVMKRKKRINAVGVVAPRSHKPPSKQQVQGSDGHGIVIGLPKGTDGDYVEFRAD
LRAAVENDVVDNDYTYDYETVEYSNPYTTDGRADVNKFRDPNDIAAHYLRTSKGNTKKYY
IAAKEVFWNYAENKIAKQYRNKTSGRNRSKPKYKKVIFRSYTDSSFKSPDAYGEYDEHLG
ILGPVVRAEVGDVIQIVFRNLASRPYSLHAHGVSFDKSSEGAGYEDGSPEWFKEDNAIQP
NNTYTYVWHVRSKSGPESHESACRAWVYYSSVDSDKDINSGLIGPLLICRKGTLDRSTNR
PLDAREFVLLFMTFDETKSWYFKENSKENCKTFHKNSPEFLKCNRFHAINGVIFNLQGLL
MYEDEPVRWHLINMGQPKDFQSIHFHGQTFTENRAKEYRFSVYTLLPGSFGTIEMRPSKP
GVWLLDSEVGECQQAGMQALFHILDKDEMHVVMLTSDGEGTFRDVSVSTKDGWEPRLARL
NNVGRYNAWSTDAEGDFYSAWIQVDLERPMVIYSIATQGAKQFWNSLYIMEFVVRYSKDE
KRWNYFKGNSNRHRKYFQGNSDAYGVKINTFDPPIIARYIRVYPTNHYKRPTLRMELYGC
DLDACSLPLGMENGAIEKNQISASSFYKSFLQSWEPSLARLNTEGYTNAWQAESNNNDQW
LQVDLLQFKKISGIITQGASSFGTEKFVRTFAVQHSSDGEKWIPYLKESTEKIFTGNVNS
HGHVRNYFDPPIFARFIRIIPRTWTKGICLRLEILGCDVV
Download sequence
Identical sequences H3B966
ENSLACP00000018437 ENSLACP00000018437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]