SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000019862 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000019862
Domain Number 1 Region: 501-579
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 7.11e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000128
Further Details:      
 
Domain Number 2 Region: 279-318
Classification Level Classification E-value
Superfamily WW domain 0.00000578
Family WW domain 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000019862
Domain Number - Region: 616-684
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000513
Family Double-stranded RNA-binding domain (dsRBD) 0.016
Further Details:      
 
Domain Number - Region: 9-22
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000019862   Gene: ENSLACG00000017462   Transcript: ENSLACT00000020000
Sequence length 771
Comment pep:novel scaffold:LatCha1:JH126620.1:2117166:2136857:1 gene:ENSLACG00000017462 transcript:ENSLACT00000020000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEESQPCPPPLPPNQQPPPPPLQTSSDAELMDVGSGGDGQFVTPAGDSNTCNKELLLTK
GSASYNSRLVEDLETRDQSPRTARHAPPVPKFVPDLKLLKDVKISVSFTESCKSKDRKVL
YTGFEEELEADVGLNSESLNGDLHDLLNSSDGKAGGSNGENDDRRESDNDTYQEKRVEFA
VLDELEEFTDNVMETDGEGAGFVSEAIIQQSQVDEEAFNYSYEEDFDNDVDALLEEGLPV
PKKKMRMEEKYGAESDHQSDGEMSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGI
PVYLHRESRVVTWSRPYFLGTGSIRKHDPPVSSIPCLHYKKMKAQEEKEQNGEVTPNGEQ
SPVKSTDLPSDSGERDEEPDSTANEETLAADAAPAEAVGSGTCEDKDVAGGDSAQGALGQ
VKAKVEVCKDESVDIEEFKSYLKKRFDFEQVTVKKFRTWAERRQFNREMKRKQAEAERPI
LPANQKLITLSVQDAPMKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPF
GASVIIDGVTYGTGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSDELEYFNHIS
IEDSRVYELTNKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMACGKHTV
RGWCKXKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESNKMVKQETSDKSVIELQQYA
KKNKPNLHILNKLQEEMRKLAREREETRKKPKMSVMESAQPGSEPLCTVDV
Download sequence
Identical sequences H3BD91
ENSLACP00000019862 ENSLACP00000019862 ENSLACP00000022436 XP_014340643.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]