SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020146 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020146
Domain Number 1 Region: 25-122
Classification Level Classification E-value
Superfamily DEATH domain 1.93e-18
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020146   Gene: ENSLACG00000017705   Transcript: ENSLACT00000020284
Sequence length 567
Comment pep:novel scaffold:LatCha1:JH126573.1:2300147:2334792:-1 gene:ENSLACG00000017705 transcript:ENSLACT00000020284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRREAHDFQYFTMSALSDLDGDDEECWNSLERFRVKLISVIEPSRITPYLRQCKVMNHD
DEEQLYSDPSLVLRKRRVGVLLDMLQRTGHKGYVAFLESLELYYPDLYKKLTGKDPSRVF
SMIIDTAGESSLGQLLMNEVMKLQQVIQEEKHKIRELNQQLNAKEDIIKQLQVKDNELRK
HQERFRKMKEERDNFSEELKKCKDENYELALRLARLSEEKNTALMKNRDLQLEIEKLKHN
LMKAEDDCKVERKHTMKLKHAMEQRPSQEVIWEVRRENDLLKAQIQELQSSMQVTKEDSS
EKNKMYIQILEDDRRLALEEHQEKVNTIYTLRKEFRQAEELRDKYMEEKEVFELQCMNLK
KDSKMYKERIEAILQQMEEVTAERDQALRTREQFHLQYSKSLVDKDMYRKQIQELGEKYD
ELQIQLFKTEGQLLALETKLKRVNLEPPTPTSDVDDISPRSSQDLFNPRIPDDVQNVKKD
QPKSDLPYGRQDSWMKEAELPKSTENRDDFFKNDGPSNGKPHRQERRFHISFDHRRKRAL
RLRNDTGQEGVDCENTTGSDNTDTEGT
Download sequence
Identical sequences H3BE25
ENSLACP00000020146 ENSLACP00000020146 XP_005987448.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]