SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020190 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020190
Domain Number 1 Region: 51-121
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000369
Family Phosphotyrosine-binding domain (PTB) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020190   Gene: ENSLACG00000017745   Transcript: ENSLACT00000020330
Sequence length 136
Comment pep:novel scaffold:LatCha1:JH126613.1:2344035:2348535:-1 gene:ENSLACG00000017745 transcript:ENSLACT00000020330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLMSTEADSSVPLPAASAKTVSRKLSKKSKSPGYKKHTNLFKLRTRTHERTGEYLRTRFQ
GDGVRYKAKLIGIDEVPNSEGDKMCLDSMMKLKGCEVANRSKGKHKQRIWLKISSVGIKV
IMHFPPVKKFIHWVFL
Download sequence
Identical sequences H3BE69
ENSLACP00000020190 ENSLACP00000020190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]