SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020411 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020411
Domain Number 1 Region: 292-391
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000138
Family SH2 domain 0.0024
Further Details:      
 
Domain Number 2 Region: 21-146
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000342
Family Phosphotyrosine-binding domain (PTB) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020411   Gene: ENSLACG00000017939   Transcript: ENSLACT00000020551
Sequence length 442
Comment pep:novel scaffold:LatCha1:JH126591.1:2525151:2555666:1 gene:ENSLACG00000017939 transcript:ENSLACT00000020551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAQCGADGSPLGTETGKLNYTRDCLHILLQYVGSFAVEGQEKDDKTKKIQQQLQALKVEK
KKKKKKKSFKIKAIIEVLKSEGETVLMAHALRRIFYSTCCSADCQFAFVARNPNQHELYC
HLFVGAQPSEVPVLNLLLCRMFQLSYLQNCPEARNKTLLTPSSPETVGSHWRSLRSPLTR
EPFQSEEVSLNINALVSIKRLSYQNIIENEGKKVVNFESQKPLTHLHIDSPYVSPTLVRK
KAIRNKVIRSGAYRSINYASQLQRSVHESFFPPVVLHPWRCGESESCQFIHFPKNEDLLM
EAVWSFAGISRECGEALLKQDVLGSFMLWETPEKINCWSLTVRTPFGIIVYQIYKSHLGK
YCMEHLQTEFPSMEALIKHHMESKGGLLCCLDISRINYCYVEQDGTGSPGLGLPLDPCEN
LDPIVESTPLGEETKVVEVALV
Download sequence
Identical sequences H3BEU0
ENSLACP00000020411 ENSLACP00000020411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]