SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020842 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020842
Domain Number 1 Region: 52-81
Classification Level Classification E-value
Superfamily WW domain 0.0000129
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020842   Gene: ENSLACG00000018311   Transcript: ENSLACT00000020982
Sequence length 1474
Comment pep:novel scaffold:LatCha1:JH126582.1:3030356:3086240:1 gene:ENSLACG00000018311 transcript:ENSLACT00000020982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMTAALQIGDQLILEEDYDDSYIPSEQVLLAFFSPQGLWWLAIYLLLYKVPGNGYCESQD
VTGDVYYFNFATGQSTWDHPCDEHYRTLVNQERERLQVQNAAKKKDKKRKKEKKEKKEKR
DQLKPPLALSSPLAPVQSLGLPQAPLGGLAPLRGLVDSSGSTLRGSLGSTASSSGGLELA
TTQLGSSGTIGGLRAGGLSAGLLGMKHEERVSLTLPGLEEDQEDESQNESPRGTARLMRN
LHMDVGSLGGGFEYEKEDSLRESQIEGRDKTPLDSGSHGACPPTPHRTGLGKETDLDSDL
SEGEPKAKSETAGQEVESDPNHNHGAENAKMKFKQRRGVLSKGAAILISDEEEKEDKENH
SSSTDGTGRQSRLAMGGEAVGDKEKDIIKMKDGIRESEPSEQIKELHLSGPLEDLSNKDK
VSFNTKEFGFRSRVSEQVMDVEALLPALSDTEKEICKPIQPVSPHSDTEKADNYLLIYIK
KILSDRNLYPNCPCKSGAEKTVEKVSLEEERTKRAEAAERWWEKSVLGLIFKTGKEKKMG
RLGEGEPNPLVNGPMTVDQRSEEQGNKEASRLERFEREDVEASNQAQLAPPAEERIRQKE
TLKRPSQESLEESQREADTKLEQERSRIRREEEERILKLREELRREEEEKARELHQEKEN
KLRSVSHCGKNSIVSRDDRKRADILNRVPTILCRVFQKGCRRVEVGIRAMKYGGKRLMRS
GVALASPAPVRALEALEKRQALELKELKSTAEEKHQKVNLCSVNFSKEQQRNGCIVELHK
VRSLLQMDHCCHLQVLLLYERHIALVSSLQKQITEVQSSEEVQLQGDLRRAQQKVQQAAD
YERELGDLLKEKRKEVEKEHGQKMEKMKEEHQQTLERIRDDYEEEERKLREKLLRSLKEE
CERLTGAHEREITGLRRDLEQRLSELQQNHRDKETKLQDLENQLELRSREIKAKAAQFKS
QEELIRKQRQQLHDEEEQLTKERAEAPSARLCKQELEESRLELHSVKGSIRQSRGDLEQL
QQRKAELESEVETLQNKIETLQSRVSELEAGVQKREEAIKETLVSNDVSLAGEEVEGALC
VEDLRKSLKTAQKVGSSSRTEEEEDVSIDDLRHYISAEGASIKKAKEFLTRQTRSLRKRQ
AALKAAKRQWCHDLLKVEGEVQGPESSLILEDARKSLDQESKHLDEMKSAMRKGQVLLRK
KEEKLNQLESSLLEELSDEDTLKGTGYKKVVTFDLSDSDDLSSIISTDLPALKIWGVSVV
DLKPVLTLPHPSKVQYLSDSLQRITSDLNTVLSVLGSLGKQQSPLFTSTQFLAPSPPSEG
VPLSAYTSLTRTPATGSCNSIPLPKQWAWSTGANPNLSASTAQSVDDILTEKWSKYFPGG
IQSLSANPAPLNGRPGYISASEQIRLLQRSQLRVPETDRNAIQGMIDANKKWLDSFKKDP
KFSPLFTKTNKTPSNHGILQLGLDENNQIKVYHY
Download sequence
Identical sequences H3BG21
ENSLACP00000020842 ENSLACP00000020842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]