SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021380 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021380
Domain Number 1 Region: 843-1035
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00068
Further Details:      
 
Domain Number 2 Region: 39-74
Classification Level Classification E-value
Superfamily WW domain 0.00000000593
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021380   Gene: ENSLACG00000018784   Transcript: ENSLACT00000021521
Sequence length 1040
Comment pep:novel scaffold:LatCha1:JH126566.1:4498258:4650338:-1 gene:ENSLACG00000018784 transcript:ENSLACT00000021521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSDWVEIIEPRSRERMYVNLGTGECGWEPPLDVKVRQSDENQWWELFDQNNNRFYYY
NAITRQTVWHRPQNCDIVPLAQLQAMKRSSQSDLRGRGGSEGALQRGSAGNEGRGTPVQL
AFLQEVEKAREVVKGRGDSLENRKDPGRENAHKWQPAPGTKAAMLVKVNSVRNPVSAQDN
SLYNQPVIYQKPQGVKPAGYVQPQQAARIQLVNKNASPATTDKQSMHIKKVENGGFCLVL
ANDNIPNYQTPQRTQTGTPRSMSPKHGSPPPIYDEPSMESPIYDEPPMEIDIEDASPSGP
PSVQVSPHHSLQKHTQPPNLQQHVLMKHKRNPSATEYSPAGREYIKHMVNIDQSSKQPHS
PPGTTDSSTKMQTGPLASKDSFKQSWRVLEANVLKNIEAHHSRQSSLHLQEYPTVISQQD
SGYSTGPSPSLRKRKGRRQAPGQGRPGSVGSSSELNALNDKLIAEMRAVVGRSVANRGSK
ASLDTELSENSMAVDNNKVRLQSDHLKKYGSHGSRSDVTASNRSLYRPGSDVRASFNSEA
STQQETVRQKRTYEKVDSLEKSITSQTSLVSPDPLRTPSQPGTLESSYKLENSGQSCSVN
STIGYRFPYTTLRKPLPETSMADWASKNLNLHTQGIFRRRMSLSNMLSWNGGSIKKPMLI
TSDRTIKKEACEMFKLVQVYMGDRQARMDQNHVALVLVTKCWSVQGLRDELYVQLVRQTT
DNLCYRSLALGWELMAISLAFFSPSPKFQSYLEGYIYRHLDPVNDRKLIMRIKELADVKT
KKNSKSRKKRKQNTEEEGLPISTYAKYCYRKLQKVAITGGKKGLRKPTVEEIEHAKNAIL
TPSLFGSSLEEIMLRQQELYPDRKLPWIQTELSQQVLAHGGAQTEGIFRVPGDIDEVNAL
KLQVDQWRIPESLADSNIPASLLKLWYRELEEPLIPQKFYKQCISNYENPEAAVAVVHLL
PELNRLVLGYLIHFLQIFAQPANVSKTKMDVNNLAMVMAPNCLRCQSDDPRVIFENTRKE
MSFLRMLIVHLDTSFIKGVL
Download sequence
Identical sequences H3BHK9
ENSLACP00000021380 ENSLACP00000021380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]