SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021453 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021453
Domain Number 1 Region: 148-407
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-87
Family Protein kinases, catalytic subunit 0.00000000146
Further Details:      
 
Domain Number 2 Region: 10-117
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000601
Family Pleckstrin-homology domain (PH domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021453   Gene: ENSLACG00000018851   Transcript: ENSLACT00000021594
Sequence length 488
Comment pep:novel scaffold:LatCha1:JH126578.1:4934635:4957024:-1 gene:ENSLACG00000018851 transcript:ENSLACT00000021594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAESRKHSDGWVNQKCEIGEYIKTWRARYFLLKSDGSFIGYKEKPETSDHILPPLNNFSV
GVCYCFQPPPPPKKTFISNCFRLSTFGLDCGLVLEEWTRAIQAVANSLKSQEQDDEMESM
DFKCGSPNDSMGAEEMEVVVSKTHVYKTMNDFDYLKLLGKGTFGKVILVREKASGQHYAM
KILRKEVIIAKKRDSLSKTMREREICEQINTLHPSLTTLKYAFQTNDRLCFVMEYANGGE
LFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHIKITDFGL
CKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHE
RLFELILMEDIRFPRTLSPDAKSLLAGLLKKDPKQRPTSKGFLQGKTGNPAEMSRLHLVL
YGKITTPKPTNQNTPRLCVDAADTLKRYFFIHFFFFFLLPSTDDDFDSEEADQKTHFPQF
SYSASIRE
Download sequence
Identical sequences H3BHT2
ENSLACP00000021453 ENSLACP00000021453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]