SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021584 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021584
Domain Number 1 Region: 137-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-47
Family Nuclear receptor ligand-binding domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 27-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-28
Family Nuclear receptor 0.0000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021584   Gene: ENSLACG00000018964   Transcript: ENSLACT00000021725
Sequence length 375
Comment pep:novel scaffold:LatCha1:JH126568.1:5804585:5815479:-1 gene:ENSLACG00000018964 transcript:ENSLACT00000021725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIVLAFPIEERLPMKRKKGPAPKMLGNEVCSVCGDKASGFHYNVLSCEGCKGFFRRSVIK
SAQYTCKNGGKCEMDMYMRRKCQECRLRKCREAGMLEQCVLSEEQIRLKKKKKQDDDLAK
TCTPPQYPCLLTEVQKLTPDQVEMIDKLVAAQQQCNKRSFTDRLKVTVSPPPPPLPTFPR
SGTFRSQCFLISIVTCDGFQKQPISFAQNKFLCKLELLKFIFIKVMLLETSRRYNPEIES
ITFLKDFSYNRDDFAKAGLQFEFINPIFEFSKGMKELKLDNAEYALLIAINIFSADRPNV
QDHDLVERLQQPYVDALHSYIRIKRPNDHLMFPRMLMKLVSLRTLSSVHSEQVFALRLQD
KKLPPLLSEIWDVHE
Download sequence
Identical sequences H3BI63
ENSLACP00000021584 ENSLACP00000021584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]